Lineage for d3c3ma1 (3c3m A:3-123)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856018Species Methanoculleus marisnigri [TaxId:368407] [188339] (1 PDB entry)
  8. 2856019Domain d3c3ma1: 3c3m A:3-123 [173020]
    Other proteins in same PDB: d3c3ma2
    automated match to d1nxoa_
    complexed with gol

Details for d3c3ma1

PDB Entry: 3c3m (more details), 1.7 Å

PDB Description: crystal structure of the n-terminal domain of response regulator receiver protein from methanoculleus marisnigri jr1
PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d3c3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3ma1 c.23.1.0 (A:3-123) automated matches {Methanoculleus marisnigri [TaxId: 368407]}
ytilvvddspmivdvfvtmlerggyrpitafsgeeclealnatppdlvlldimmepmdgw
etleriktdpatrdipvlmltakpltpeeaneygsyiedyilkptthhqlyeaiehvlar
r

SCOPe Domain Coordinates for d3c3ma1:

Click to download the PDB-style file with coordinates for d3c3ma1.
(The format of our PDB-style files is described here.)

Timeline for d3c3ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c3ma2