SCOPe 2.08: Domain d3c3ma1: 3c3m A:3-123

Lineage for d3c3ma1 (3c3m A:3-123)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Methanoculleus marisnigri [TaxId:368407] [188339] (1 PDB entry)

8. Domain d3c3ma1: 3c3m A:3-123 [173020]
   Other proteins in same PDB: d3c3ma2
   automated match to d1nxoa_
   complexed with gol

Details for d3c3ma1

PDB Entry: 3c3m, 1.7 Å

PDB Description: crystal structure of the n-terminal domain of response regulator receiver protein from methanoculleus marisnigri jr1

PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d3c3ma1:

Sequence; same for both SEQRES and ATOM records:

>d3c3ma1 c.23.1.0 (A:3-123) automated matches {Methanoculleus marisnigri [TaxId: 368407]}
ytilvvddspmivdvfvtmlerggyrpitafsgeeclealnatppdlvlldimmepmdgw
etleriktdpatrdipvlmltakpltpeeaneygsyiedyilkptthhqlyeaiehvlar
r

Timeline for d3c3ma1:

• d3c3ma1 first appeared in SCOPe 2.01, called d3c3ma_
  
• d3c3ma1 appears in SCOPe 2.07