Lineage for d3c3kb_ (3c3k B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1878507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1878777Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1878778Protein automated matches [190646] (60 species)
    not a true protein
  7. 1878779Species Actinobacillus succinogenes [TaxId:339671] [188337] (1 PDB entry)
  8. 1878781Domain d3c3kb_: 3c3k B: [173019]
    automated match to d1sxga_
    complexed with cl, gol

Details for d3c3kb_

PDB Entry: 3c3k (more details), 1.99 Å

PDB Description: crystal structure of an uncharacterized protein from actinobacillus succinogenes
PDB Compounds: (B:) alanine racemase

SCOPe Domain Sequences for d3c3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3kb_ c.93.1.0 (B:) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
ktgmllvmvsnianpfcaavvkgiektaekngyrillcntesdlarsrscltllsgkmvd
gvitmdalselpelqniigafpwvqcaeydplstvssvsiddvaaseyvvdqlvksgkkr
ialinhdlayqyaqhresgylnrlkfhgldysrisyaenldymagklatfsllksavkpd
aifaisdvlaagaiqaltesglsipqdvavvgfdgvdisqitvpalttvqqpseqigmka
vsllleqihsdvlaktvhhllpwkfvrrqsse

SCOPe Domain Coordinates for d3c3kb_:

Click to download the PDB-style file with coordinates for d3c3kb_.
(The format of our PDB-style files is described here.)

Timeline for d3c3kb_: