![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Actinobacillus succinogenes [TaxId:339671] [188337] (2 PDB entries) |
![]() | Domain d3c3kb1: 3c3k B:7-277 [173019] Other proteins in same PDB: d3c3ka2, d3c3kb2 automated match to d1sxga_ complexed with cl, gol |
PDB Entry: 3c3k (more details), 1.99 Å
SCOPe Domain Sequences for d3c3kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c3kb1 c.93.1.0 (B:7-277) automated matches {Actinobacillus succinogenes [TaxId: 339671]} ktgmllvmvsnianpfcaavvkgiektaekngyrillcntesdlarsrscltllsgkmvd gvitmdalselpelqniigafpwvqcaeydplstvssvsiddvaaseyvvdqlvksgkkr ialinhdlayqyaqhresgylnrlkfhgldysrisyaenldymagklatfsllksavkpd aifaisdvlaagaiqaltesglsipqdvavvgfdgvdisqitvpalttvqqpseqigmka vsllleqihsdvlaktvhhllpwkfvrrqss
Timeline for d3c3kb1: