Lineage for d3c2xc_ (3c2x C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2972808Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2972872Protein automated matches [190549] (4 species)
    not a true protein
  7. 2972875Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries)
  8. 2972886Domain d3c2xc_: 3c2x C: [173002]
    automated match to d1ycka1
    complexed with gol, so4, tla

Details for d3c2xc_

PDB Entry: 3c2x (more details), 1.83 Å

PDB Description: Crystal structure of peptidoglycan recognition protein at 1.8A resolution
PDB Compounds: (C:) Peptidoglycan recognition protein

SCOPe Domain Sequences for d3c2xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2xc_ d.118.1.1 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d3c2xc_:

Click to download the PDB-style file with coordinates for d3c2xc_.
(The format of our PDB-style files is described here.)

Timeline for d3c2xc_: