SCOPe 2.04: Domain d3c2xb_: 3c2x B:

Lineage for d3c2xb_ (3c2x B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein automated matches [190549] (4 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (28 PDB entries)

8. Domain d3c2xb_: 3c2x B: [173001]
   automated match to d1ycka1
   complexed with gol, so4, tla

Details for d3c2xb_

PDB Entry: 3c2x, 1.83 Å

PDB Description: Crystal structure of peptidoglycan recognition protein at 1.8A resolution

PDB Compounds: (B:) Peptidoglycan recognition protein

SCOPe Domain Sequences for d3c2xb_:

Sequence; same for both SEQRES and ATOM records:

>d3c2xb_ d.118.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

Timeline for d3c2xb_:

• d3c2xb_ first appeared in SCOPe 2.01
  
• d3c2xb_ appears in SCOPe 2.03
  
• d3c2xb_ appears in SCOPe 2.05
  
• d3c2xb_ appears in the current release, SCOPe 2.08