Lineage for d1osa__ (1osa -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47648Protein Calmodulin [47516] (7 species)
  7. 47661Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [47523] (3 PDB entries)
  8. 47663Domain d1osa__: 1osa - [17300]

Details for d1osa__

PDB Entry: 1osa (more details), 1.68 Å

PDB Description: crystal structure of recombinant paramecium tetraurelia calmodulin at 1.68 angstroms resolution

SCOP Domain Sequences for d1osa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osa__ a.39.1.5 (-) Calmodulin {Ciliate (Paramecium tetraurelia)}
aeqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltdde
vdemireadidgdghinyeefvrmmvsk

SCOP Domain Coordinates for d1osa__:

Click to download the PDB-style file with coordinates for d1osa__.
(The format of our PDB-style files is described here.)

Timeline for d1osa__: