Lineage for d3c1ua_ (3c1u A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103132Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2103177Family c.23.10.4: Rhamnogalacturonan acetylesterase [52276] (1 protein)
    automatically mapped to Pfam PF00657
  6. 2103178Protein Rhamnogalacturonan acetylesterase [52277] (1 species)
  7. 2103179Species Fungus (Aspergillus aculeatus) [TaxId:5053] [52278] (5 PDB entries)
  8. 2103181Domain d3c1ua_: 3c1u A: [172998]
    automated match to d1deoa_
    complexed with act, nag; mutant

Details for d3c1ua_

PDB Entry: 3c1u (more details), 1.33 Å

PDB Description: D192N mutant of Rhamnogalacturonan acetylesterase
PDB Compounds: (A:) Rhamnogalacturonan acetylesterase

SCOPe Domain Sequences for d3c1ua_:

Sequence, based on SEQRES records: (download)

>d3c1ua_ c.23.10.4 (A:) Rhamnogalacturonan acetylesterase {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
ttvylagdstmakngggsgtngwgeylasylsatvvndavagrsarsytregrfeniadv
vtagdyvivefghndggslstdngrtdcsgtgaevcysvydgvnetiltfpaylenaakl
ftakgakvilssqtpnnpwetgtfvnsptrfveyaelaaevagveyvdhwsyvdsiyetl
gnatvnsyfpinhthtspagaevvaeaflkavvctgtslksvltttsfegtcl

Sequence, based on observed residues (ATOM records): (download)

>d3c1ua_ c.23.10.4 (A:) Rhamnogalacturonan acetylesterase {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
ttvylagdstmakngggsgtngwgeylasylsatvvndavagrsarsytregrfeniadv
vtagdyvivefghndggstdngrtdcsgtgaevcysvydgvnetiltfpaylenaaklft
akgakvilssqtpnnpwetgtfvnsptrfveyaelaaevagveyvdhwsyvdsiyetlgn
atvnsyfpinhthtspagaevvaeaflkavvctgtslksvltttsfegtcl

SCOPe Domain Coordinates for d3c1ua_:

Click to download the PDB-style file with coordinates for d3c1ua_.
(The format of our PDB-style files is described here.)

Timeline for d3c1ua_: