Lineage for d3c1li_ (3c1l I:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926643Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 926644Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 926700Family a.152.1.3: Atu0492-like [140970] (6 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 926743Protein automated matches [190902] (1 species)
    not a true protein
  7. 926744Species Mesorhizobium loti [TaxId:266835] [188336] (1 PDB entry)
  8. 926753Domain d3c1li_: 3c1l I: [172994]
    automated match to d2pfxa1
    complexed with cl, peg

Details for d3c1li_

PDB Entry: 3c1l (more details), 2 Å

PDB Description: crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution
PDB Compounds: (I:) Putative antioxidant defense protein Mlr4105

SCOPe Domain Sequences for d3c1li_:

Sequence, based on SEQRES records: (download)

>d3c1li_ a.152.1.3 (I:) automated matches {Mesorhizobium loti [TaxId: 266835]}
gkisaldlasgelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlges
glskldremiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtam
lefavklteepakiveadraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndey
hamar

Sequence, based on observed residues (ATOM records): (download)

>d3c1li_ a.152.1.3 (I:) automated matches {Mesorhizobium loti [TaxId: 266835]}
gkisaldelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlgesglsk
ldremiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtamlefa
vklteepakiveadraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndeyhama
r

SCOPe Domain Coordinates for d3c1li_:

Click to download the PDB-style file with coordinates for d3c1li_.
(The format of our PDB-style files is described here.)

Timeline for d3c1li_: