Class a: All alpha proteins [46456] (284 folds) |
Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) probable biological unit contains six domains of this fold arranged with 32 symmetry |
Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
Protein automated matches [190902] (1 species) not a true protein |
Species Mesorhizobium loti [TaxId:266835] [188336] (1 PDB entry) |
Domain d3c1lh_: 3c1l H: [172993] automated match to d2pfxa1 complexed with cl, peg |
PDB Entry: 3c1l (more details), 2 Å
SCOPe Domain Sequences for d3c1lh_:
Sequence, based on SEQRES records: (download)
>d3c1lh_ a.152.1.3 (H:) automated matches {Mesorhizobium loti [TaxId: 266835]} kisaldlasgelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlgesg lskldremiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtaml efavklteepakiveadraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndeyh amar
>d3c1lh_ a.152.1.3 (H:) automated matches {Mesorhizobium loti [TaxId: 266835]} kisaldelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlgesglskl dremiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtamlefav klteepakiveadraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndeyhamar
Timeline for d3c1lh_: