SCOPe 2.01: Domain d3c1le_: 3c1l E:

Lineage for d3c1le_ (3c1l E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.3: Atu0492-like [140970] (6 proteins)
   duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family

6. Protein automated matches [190902] (1 species)
   not a true protein

7. Species Mesorhizobium loti [TaxId:266835] [188336] (1 PDB entry)

8. Domain d3c1le_: 3c1l E: [172990]
   automated match to d2pfxa1
   complexed with cl, peg

Details for d3c1le_

PDB Entry: 3c1l, 2 Å

PDB Description: crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution

PDB Compounds: (E:) Putative antioxidant defense protein Mlr4105

SCOPe Domain Sequences for d3c1le_:

Sequence, based on SEQRES records:

>d3c1le_ a.152.1.3 (E:) automated matches {Mesorhizobium loti [TaxId: 266835]}
kisaldlasgelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlgesg
lskldremiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtaml
efavklteepakiveadraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndeyh
amar

Sequence, based on observed residues (ATOM records):

>d3c1le_ a.152.1.3 (E:) automated matches {Mesorhizobium loti [TaxId: 266835]}
kisaldgelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlgesglsk
ldremiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtamlefa
vklteepakiveadraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndeyhama
r

Timeline for d3c1le_:

• d3c1le_ is new in SCOPe 2.01-stable
  
• d3c1le_ appears in SCOPe 2.02
  
• d3c1le_ appears in the current release, SCOPe 2.08