Lineage for d1exra_ (1exr A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914403Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 914454Protein Calmodulin [47516] (11 species)
  7. 914527Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [47523] (4 PDB entries)
    Uniprot Q42478
  8. 914528Domain d1exra_: 1exr A: [17299]
    complexed with ca

Details for d1exra_

PDB Entry: 1exr (more details), 1 Å

PDB Description: the 1.0 angstrom crystal structure of ca+2 bound calmodulin
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d1exra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
eqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
tidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddev
demireadidgdghinyeefvrmmvs

SCOPe Domain Coordinates for d1exra_:

Click to download the PDB-style file with coordinates for d1exra_.
(The format of our PDB-style files is described here.)

Timeline for d1exra_: