Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) |
Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins) barrel, closed; n=5, S=10 |
Protein Staphylococcal nuclease [50201] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50202] (268 PDB entries) Uniprot P00644 89-223 |
Domain d3c1fa_: 3c1f A: [172985] automated match to d1joka_ complexed with ca, thp |
PDB Entry: 3c1f (more details), 2 Å
SCOPe Domain Sequences for d3c1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1fa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]} lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki evefdkgqrtdkygrglayiyadgkmvnealkrqglakvayvykgnntheqllrkaeaqa kkeklniws
Timeline for d3c1fa_: