SCOPe 2.04: Domain d3c0vb_: 3c0v B:

Lineage for d3c0vb_ (3c0v B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (19 species)
   not a true protein

7. Species Mung bean (Vigna radiata) [TaxId:157791] [187717] (3 PDB entries)

8. Domain d3c0vb_: 3c0v B: [172978]
   automated match to d1fm4a_
   complexed with epe, na, tbr, zea

Details for d3c0vb_

PDB Entry: 3c0v, 1.8 Å

PDB Description: crystal structure of cytokinin-specific binding protein in complex with cytokinin and ta6br12

PDB Compounds: (B:) cytokinin-specific binding protein

SCOPe Domain Sequences for d3c0vb_:

Sequence; same for both SEQRES and ATOM records:

>d3c0vb_ d.129.3.0 (B:) automated matches {Mung bean (Vigna radiata) [TaxId: 157791]}
mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
dhdsdieekvtptktsqstlmylrrleryls

Timeline for d3c0vb_:

• d3c0vb_ first appeared in SCOPe 2.01
  
• d3c0vb_ appears in SCOPe 2.03
  
• d3c0vb_ appears in SCOPe 2.05
  
• d3c0vb_ appears in the current release, SCOPe 2.08