![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (4 species) not a true protein |
![]() | Species Mung bean (Vigna radiata) [TaxId:157791] [187717] (2 PDB entries) |
![]() | Domain d3c0va_: 3c0v A: [172977] automated match to d1fm4a_ complexed with epe, na, tbr, zea |
PDB Entry: 3c0v (more details), 1.8 Å
SCOPe Domain Sequences for d3c0va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c0va_ d.129.3.0 (A:) automated matches {Mung bean (Vigna radiata) [TaxId: 157791]} mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy dhdsdieekvtptktsqstlmylrrleryls
Timeline for d3c0va_: