SCOPe 2.06: Domain d3c0ub1: 3c0u B:2-180

Lineage for d3c0ub1 (3c0u B:2-180)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.0: automated matches [191531] (1 protein)
   not a true family

6. Protein automated matches [190900] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188330] (1 PDB entry)

8. Domain d3c0ub1: 3c0u B:2-180 [172976]
   Other proteins in same PDB: d3c0ua2, d3c0ub2
   automated match to d2g3wa1
   complexed with cl, so4

Details for d3c0ub1

PDB Entry: 3c0u, 2.7 Å

PDB Description: Crystal structure of E.coli yaeQ protein

PDB Compounds: (B:) Uncharacterized protein yaeQ

SCOPe Domain Sequences for d3c0ub1:

Sequence, based on SEQRES records:

>d3c0ub1 c.52.1.0 (B:2-180) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alkatiykatvnvadldrnqfldasltlarhpsetqermmlrllawlkyaderlqftrgl
caddepeawlrndhlgidlwielglpderrikkactqaaevalftynsraaqiwwqqnqs
kcvqfanlsvwylddeqlakvsafadrtmtlqatiqdgviwlsddknnlevnltawqqp

Sequence, based on observed residues (ATOM records):

>d3c0ub1 c.52.1.0 (B:2-180) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alkatiykatvnvadldrnqfldasltlarhpsetqermmlrllawlkyaderlqftrgl
cddepeawlrndhlgidlwielglpderrikkactqaaevalftynsraaqiwwqqnqsk
cvqfanlsvwylddeqlakvsafadrtmtlqatiqdgviwlsddknnlevnltawqqp

Timeline for d3c0ub1:

• d3c0ub1 first appeared in SCOPe 2.01, called d3c0ub_
  
• d3c0ub1 was called d3c0ub_ in SCOPe 2.05
  
• d3c0ub1 appears in SCOPe 2.07
  
• d3c0ub1 appears in the current release, SCOPe 2.08