Lineage for d3c0ua_ (3c0u A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994813Family c.52.1.0: automated matches [191531] (1 protein)
    not a true family
  6. 994814Protein automated matches [190900] (1 species)
    not a true protein
  7. 994815Species Escherichia coli K-12 [TaxId:83333] [188330] (1 PDB entry)
  8. 994816Domain d3c0ua_: 3c0u A: [172975]
    automated match to d2g3wa1
    complexed with cl, so4

Details for d3c0ua_

PDB Entry: 3c0u (more details), 2.7 Å

PDB Description: Crystal structure of E.coli yaeQ protein
PDB Compounds: (A:) Uncharacterized protein yaeQ

SCOPe Domain Sequences for d3c0ua_:

Sequence, based on SEQRES records: (download)

>d3c0ua_ c.52.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ghalkatiykatvnvadldrnqfldasltlarhpsetqermmlrllawlkyaderlqftr
glcaddepeawlrndhlgidlwielglpderrikkactqaaevalftynsraaqiwwqqn
qskcvqfanlsvwylddeqlakvsafadrtmtlqatiqdgviwlsddknnlevnltawqq
p

Sequence, based on observed residues (ATOM records): (download)

>d3c0ua_ c.52.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ghalkatiykatvnvadldrnqfldasltlarhpsetqermmlrllawlkyaderlqftr
ddepeawlrndhlgidlwielglpderrikkactqaaevalftynsraaqiwwqqnqskc
vqfanlsvwylddeqlakvsafadrtmtlqatiqdgviwlsddknnlevnltawqqp

SCOPe Domain Coordinates for d3c0ua_:

Click to download the PDB-style file with coordinates for d3c0ua_.
(The format of our PDB-style files is described here.)

Timeline for d3c0ua_: