SCOPe 2.08: Domain d3c0ua1: 3c0u A:2-180

Lineage for d3c0ua1 (3c0u A:2-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.0: automated matches [191531] (1 protein)
   not a true family

6. Protein automated matches [190900] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188330] (1 PDB entry)

8. Domain d3c0ua1: 3c0u A:2-180 [172975]
   Other proteins in same PDB: d3c0ua2, d3c0ub2
   automated match to d2g3wa1
   complexed with cl, so4

Details for d3c0ua1

PDB Entry: 3c0u, 2.7 Å

PDB Description: Crystal structure of E.coli yaeQ protein

PDB Compounds: (A:) Uncharacterized protein yaeQ

SCOPe Domain Sequences for d3c0ua1:

Sequence, based on SEQRES records:

>d3c0ua1 c.52.1.0 (A:2-180) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alkatiykatvnvadldrnqfldasltlarhpsetqermmlrllawlkyaderlqftrgl
caddepeawlrndhlgidlwielglpderrikkactqaaevalftynsraaqiwwqqnqs
kcvqfanlsvwylddeqlakvsafadrtmtlqatiqdgviwlsddknnlevnltawqqp

Sequence, based on observed residues (ATOM records):

>d3c0ua1 c.52.1.0 (A:2-180) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alkatiykatvnvadldrnqfldasltlarhpsetqermmlrllawlkyaderlqftrdd
epeawlrndhlgidlwielglpderrikkactqaaevalftynsraaqiwwqqnqskcvq
fanlsvwylddeqlakvsafadrtmtlqatiqdgviwlsddknnlevnltawqqp

Timeline for d3c0ua1:

• d3c0ua1 first appeared in SCOPe 2.01, called d3c0ua_
  
• d3c0ua1 appears in SCOPe 2.07