| Class g: Small proteins [56992] (100 folds) |
| Fold g.20: Blood coagulation inhibitor (disintegrin) [57551] (1 superfamily) small disulfide-rich |
Superfamily g.20.1: Blood coagulation inhibitor (disintegrin) [57552] (2 families) ![]() automatically mapped to Pfam PF00200 |
| Family g.20.1.1: Blood coagulation inhibitor (disintegrin) [57553] (7 proteins) |
| Protein automated matches [190923] (4 species) not a true protein |
| Species Agkistrodon contortrix [TaxId:8713] [188419] (1 PDB entry) |
| Domain d3c05a_: 3c05 A: [172967] automated match to d2pjia1 complexed with so4 |
PDB Entry: 3c05 (more details), 1.7 Å
SCOPe Domain Sequences for d3c05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c05a_ g.20.1.1 (A:) automated matches {Agkistrodon contortrix [TaxId: 8713]}
npccdaatckltpgsqcaeglccdqckfikagkicrrargdnpdyrctgqsgdcprkhf
Timeline for d3c05a_: