Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein PII (product of glnB) [54915] (8 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
Species Mycobacterium tuberculosis [TaxId:83332] [188403] (1 PDB entry) |
Domain d3bzqa1: 3bzq A:1-112 [172965] Other proteins in same PDB: d3bzqa2 automated match to d1hwua_ |
PDB Entry: 3bzq (more details), 1.4 Å
SCOPe Domain Sequences for d3bzqa1:
Sequence, based on SEQRES records: (download)
>d3bzqa1 d.58.5.1 (A:1-112) PII (product of glnB) {Mycobacterium tuberculosis [TaxId: 83332]} mklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpkvr ievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal
>d3bzqa1 d.58.5.1 (A:1-112) PII (product of glnB) {Mycobacterium tuberculosis [TaxId: 83332]} mklitaivkpftlddvktsledagvlgmtvseiqgygrdfvpkvrievvvddsivdkvvd sivraartgkigdgkvwvspvdtivrvrtgerghdal
Timeline for d3bzqa1: