SCOPe 2.05: Domain d3bzqa_: 3bzq A:

Lineage for d3bzqa_ (3bzq A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein PII (product of glnB) [54915] (7 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Mycobacterium tuberculosis [TaxId:83332] [188403] (1 PDB entry)

8. Domain d3bzqa_: 3bzq A: [172965]
   automated match to d1hwua_

Details for d3bzqa_

PDB Entry: 3bzq, 1.4 Å

PDB Description: High resolution crystal structure of Nitrogen Regulatory Protein (Rv2919c) of Mycobacterium tuberculosis

PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d3bzqa_:

Sequence, based on SEQRES records:

>d3bzqa_ d.58.5.1 (A:) PII (product of glnB) {Mycobacterium tuberculosis [TaxId: 83332]}
ghmklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpk
vrievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal

Sequence, based on observed residues (ATOM records):

>d3bzqa_ d.58.5.1 (A:) PII (product of glnB) {Mycobacterium tuberculosis [TaxId: 83332]}
ghmklitaivkpftlddvktsledagvlgmtvseiqgygrdfvpkvrievvvddsivdkv
vdsivraartgkigdgkvwvspvdtivrvrtgerghdal

Timeline for d3bzqa_:

• d3bzqa_ first appeared in SCOPe 2.01
  
• d3bzqa_ appears in SCOPe 2.04
  
• d3bzqa_ is called d3bzqa1 in SCOPe 2.06
  
• d3bzqa_ appears in the current release, SCOPe 2.08, called d3bzqa1