Lineage for d3bzqa1 (3bzq A:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950570Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2950609Species Mycobacterium tuberculosis [TaxId:83332] [188403] (1 PDB entry)
  8. 2950610Domain d3bzqa1: 3bzq A:1-112 [172965]
    Other proteins in same PDB: d3bzqa2
    automated match to d1hwua_

Details for d3bzqa1

PDB Entry: 3bzq (more details), 1.4 Å

PDB Description: High resolution crystal structure of Nitrogen Regulatory Protein (Rv2919c) of Mycobacterium tuberculosis
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d3bzqa1:

Sequence, based on SEQRES records: (download)

>d3bzqa1 d.58.5.1 (A:1-112) PII (product of glnB) {Mycobacterium tuberculosis [TaxId: 83332]}
mklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpkvr
ievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal

Sequence, based on observed residues (ATOM records): (download)

>d3bzqa1 d.58.5.1 (A:1-112) PII (product of glnB) {Mycobacterium tuberculosis [TaxId: 83332]}
mklitaivkpftlddvktsledagvlgmtvseiqgygrdfvpkvrievvvddsivdkvvd
sivraartgkigdgkvwvspvdtivrvrtgerghdal

SCOPe Domain Coordinates for d3bzqa1:

Click to download the PDB-style file with coordinates for d3bzqa1.
(The format of our PDB-style files is described here.)

Timeline for d3bzqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bzqa2