Lineage for d3bz2o_ (3bz2 O:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3021998Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 3022031Protein automated matches [191004] (2 species)
    not a true protein
  7. 3022038Species Thermosynechococcus elongatus [TaxId:32046] [188749] (2 PDB entries)
  8. 3022039Domain d3bz2o_: 3bz2 O: [172961]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2o_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d3bz2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d3bz2o_:

Click to download the PDB-style file with coordinates for d3bz2o_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2o_: