Lineage for d3bz2m_ (3bz2 M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026592Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 3026593Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 3026594Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 3026595Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries)
    Uniprot Q8DHA7 1-36
  8. 3026604Domain d3bz2m_: 3bz2 M: [172960]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2m_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d3bz2m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2m_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d3bz2m_:

Click to download the PDB-style file with coordinates for d3bz2m_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2m_: