SCOP 1.69: Domain d4cln__: 4cln -

Lineage for d4cln__ (4cln -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (10 species)

7. Species Drosophila melanogaster [TaxId:7227] [47522] (4 PDB entries)

8. Domain d4cln__: 4cln - [17296]

Details for d4cln__

PDB Entry: 4cln, 2.2 Å

PDB Description: structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-angstroms resolution

SCOP Domain Sequences for d4cln__:

Sequence; same for both SEQRES and ATOM records:

>d4cln__ a.39.1.5 (-) Calmodulin {Drosophila melanogaster}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
vdemireadidgdgqvnyeefvtmmtsk

Timeline for d4cln__:

• d4cln__ first appeared (with stable ids) in SCOP 1.55
  
• d4cln__ appears in SCOP 1.67
  
• d4cln__ appears in SCOP 1.71
  
• d4cln__ appears in the current release, SCOPe 2.08, called d4clna_