Lineage for d3bz2l_ (3bz2 L:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579167Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2579168Family f.23.31.1: PsbL-like [161018] (2 protein domains)
    Pfam PF02419
  6. 2579191Protein automated matches [191003] (2 species)
    not a true protein
  7. 2579194Species Thermosynechococcus elongatus [TaxId:32046] [188748] (2 PDB entries)
  8. 2579195Domain d3bz2l_: 3bz2 L: [172959]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2l_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d3bz2l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2l_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d3bz2l_:

Click to download the PDB-style file with coordinates for d3bz2l_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2l_: