SCOPe 2.08: Domain d3bz2j_: 3bz2 J:

Lineage for d3bz2j_ (3bz2 J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families)
   automatically mapped to Pfam PF01788

5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
   Pfam PF01788

6. Protein automated matches [191002] (3 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:32046] [188747] (2 PDB entries)

8. Domain d3bz2j_: 3bz2 J: [172958]
   Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2j_

PDB Entry: 3bz2, 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer

PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d3bz2j_:

Sequence; same for both SEQRES and ATOM records:

>d3bz2j_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
riplwivatvagmgvivivglffygayaglgssl

Timeline for d3bz2j_:

• d3bz2j_ first appeared in SCOPe 2.01
  
• d3bz2j_ appears in SCOPe 2.07