SCOPe 2.08: Domain d3bz2f_: 3bz2 F:

Lineage for d3bz2f_ (3bz2 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:32046] [188745] (2 PDB entries)

8. Domain d3bz2f_: 3bz2 F: [172956]
   Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2f_

PDB Entry: 3bz2, 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d3bz2f_:

Sequence; same for both SEQRES and ATOM records:

>d3bz2f_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
vsypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d3bz2f_:

• d3bz2f_ first appeared in SCOPe 2.01
  
• d3bz2f_ appears in SCOPe 2.07