Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Domain d3bz2e_: 3bz2 E: [172955] Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2z_ automated match to d2axte1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz2 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz2e_ f.23.38.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs iplvtdrfeakqqvetfleqlk
Timeline for d3bz2e_: