Lineage for d3bz1j_ (3bz1 J:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579197Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
    automatically mapped to Pfam PF01788
  5. 2579198Family f.23.32.1: PsbJ-like [161022] (2 protein domains)
    Pfam PF01788
  6. 2579208Protein automated matches [191002] (3 species)
    not a true protein
  7. 2579213Species Thermosynechococcus elongatus [TaxId:32046] [188747] (2 PDB entries)
  8. 2579215Domain d3bz1j_: 3bz1 J: [172947]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1j_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d3bz1j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1j_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
riplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d3bz1j_:

Click to download the PDB-style file with coordinates for d3bz1j_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1j_: