Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (6 species) not a true protein |
Domain d3bz1d_: 3bz1 D: [172943] Other proteins in same PDB: d3bz1b_, d3bz1c_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1z_ automated match to d2axtd1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1d_ f.26.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe tfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d3bz1d_: