Lineage for d3byte_ (3byt E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744562Domain d3byte_: 3byt E: [172937]
    Other proteins in same PDB: d3bytb1, d3bytb2, d3bytd1, d3bytd2, d3bytf1, d3bytf2, d3byth1, d3byth2
    automated match to d2aq3a1

Details for d3byte_

PDB Entry: 3byt (more details), 2.3 Å

PDB Description: A complex between a variant of staphylococcal enterotoxin C3 and the variable domain of the murine T cell receptor beta chain 8.2
PDB Compounds: (E:) T cell receptor beta chain 8.2

SCOPe Domain Sequences for d3byte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byte_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

SCOPe Domain Coordinates for d3byte_:

Click to download the PDB-style file with coordinates for d3byte_.
(The format of our PDB-style files is described here.)

Timeline for d3byte_: