| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d3bytc_: 3byt C: [172936] Other proteins in same PDB: d3bytb1, d3bytb2, d3bytd1, d3bytd2, d3bytf1, d3bytf2, d3byth1, d3byth2 automated match to d2aq3a1 |
PDB Entry: 3byt (more details), 2.3 Å
SCOPe Domain Sequences for d3bytc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bytc_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
Timeline for d3bytc_: