Lineage for d3byta_ (3byt A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024866Domain d3byta_: 3byt A: [172935]
    Other proteins in same PDB: d3bytb1, d3bytb2, d3bytd1, d3bytd2, d3bytf1, d3bytf2, d3byth1, d3byth2
    automated match to d2aq3a1

Details for d3byta_

PDB Entry: 3byt (more details), 2.3 Å

PDB Description: A complex between a variant of staphylococcal enterotoxin C3 and the variable domain of the murine T cell receptor beta chain 8.2
PDB Compounds: (A:) T cell receptor beta chain 8.2

SCOPe Domain Sequences for d3byta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byta_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

SCOPe Domain Coordinates for d3byta_:

Click to download the PDB-style file with coordinates for d3byta_.
(The format of our PDB-style files is described here.)

Timeline for d3byta_: