Lineage for d3bxya1 (3bxy A:2-274)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069518Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 protein domains)
    contains extra N-terminal 3-helical domain
  6. 2069519Protein Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51166] (3 species)
  7. 2069520Species Escherichia coli O157:H7 [TaxId:83334] [188329] (1 PDB entry)
  8. 2069521Domain d3bxya1: 3bxy A:2-274 [172927]
    Other proteins in same PDB: d3bxya2
    automated match to d1kgqa_

Details for d3bxya1

PDB Entry: 3bxy (more details), 2 Å

PDB Description: Crystal structure of tetrahydrodipicolinate N-succinyltransferase from E. coli
PDB Compounds: (A:) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

SCOPe Domain Sequences for d3bxya1:

Sequence, based on SEQRES records: (download)

>d3bxya1 b.81.1.2 (A:2-274) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Escherichia coli O157:H7 [TaxId: 83334]}
qqlqniietaferraeitpanadtvtreavnqvialldsgalrvaekidgqwvthqwlkk
avllsfrindnqviegaesryfdkvpmkfadydearfqkegfrvvppaavrqgafiarnt
vlmpsyvnigayvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanptiiedn
cfigarsevvegviveegsvismgvyigqstriydretgdihygrvpagsvvvsgnlpsk
dgkyslycavivkkvdaktrgkvginellrtid

Sequence, based on observed residues (ATOM records): (download)

>d3bxya1 b.81.1.2 (A:2-274) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Escherichia coli O157:H7 [TaxId: 83334]}
qqlqniietaferraeitpanadtvtreavnqvialldsgalrvaekidgqwvthqwlkk
avllsfrindnqviegaesryfdkvpmkfadydearfqkegfrvvppaavrqgafiarnt
vlmpsyvnigayvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanptiiedn
cfigarsevvegviveegsvismgvyigqstriydretgdihygrvpagsvvvsgnlpsk
dgkyslycavivkkvdaktrginellrtid

SCOPe Domain Coordinates for d3bxya1:

Click to download the PDB-style file with coordinates for d3bxya1.
(The format of our PDB-style files is described here.)

Timeline for d3bxya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bxya2