![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein automated matches [190934] (3 species) not a true protein |
![]() | Species Geobacter sulfurreducens [188477] (1 PDB entry) |
![]() | Domain d3bxua_: 3bxu A: [172924] automated match to d1os6a_ complexed with hem, so4 |
PDB Entry: 3bxu (more details), 1.35 Å
SCOPe Domain Sequences for d3bxua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bxua_ a.138.1.1 (A:) automated matches {Geobacter sulfurreducens} adtmtftakngnvtfdhkkhqtivpdcavchgktpgkiegfgkemahgksckgcheemkk gptkcgechkk
Timeline for d3bxua_: