SCOPe 2.08: Domain d3bxua_: 3bxu A:

Lineage for d3bxua_ (3bxu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein automated matches [190934] (3 species)
   not a true protein

7. Species Geobacter sulfurreducens [188477] (1 PDB entry)

8. Domain d3bxua_: 3bxu A: [172924]
   automated match to d1os6a_
   complexed with hem, so4

Details for d3bxua_

PDB Entry: 3bxu, 1.35 Å

PDB Description: PpcB, A Cytochrome c7 from Geobacter sulfurreducens

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d3bxua_:

Sequence; same for both SEQRES and ATOM records:

>d3bxua_ a.138.1.1 (A:) automated matches {Geobacter sulfurreducens}
adtmtftakngnvtfdhkkhqtivpdcavchgktpgkiegfgkemahgksckgcheemkk
gptkcgechkk

Timeline for d3bxua_:

• d3bxua_ first appeared in SCOPe 2.01
  
• d3bxua_ appears in SCOPe 2.07