Lineage for d3bxcg_ (3bxc G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940534Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (24 PDB entries)
  8. 2940592Domain d3bxcg_: 3bxc G: [172921]
    automated match to d1uisa_

Details for d3bxcg_

PDB Entry: 3bxc (more details), 2.6 Å

PDB Description: monomeric far-red fluorescent protein mkate crystallized at ph 9.0
PDB Compounds: (G:) Far-red fluorescent protein mKate

SCOPe Domain Sequences for d3bxcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bxcg_ d.22.1.1 (G:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy
gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv
nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa
knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp

SCOPe Domain Coordinates for d3bxcg_:

Click to download the PDB-style file with coordinates for d3bxcg_.
(The format of our PDB-style files is described here.)

Timeline for d3bxcg_: