![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (24 PDB entries) |
![]() | Domain d3bxcc_: 3bxc C: [172917] automated match to d1uisa_ |
PDB Entry: 3bxc (more details), 2.6 Å
SCOPe Domain Sequences for d3bxcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bxcc_ d.22.1.1 (C:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]} itenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfmy gsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv nfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkpa knlkmpgvyyvdrrlerikeadketyveqhevavarycdlp
Timeline for d3bxcc_: