SCOPe 2.07: Domain d3bxbf_: 3bxb F:

Lineage for d3bxbf_ (3bxb F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (22 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (23 PDB entries)

8. Domain d3bxbf_: 3bxb F: [172912]
   automated match to d1uisa_

Details for d3bxbf_

PDB Entry: 3bxb, 2.6 Å

PDB Description: monomeric far-red fluorescent protein mkate crystallized at ph 7.0

PDB Compounds: (F:) Far-red fluorescent protein mKate

SCOPe Domain Sequences for d3bxbf_:

Sequence; same for both SEQRES and ATOM records:

>d3bxbf_ d.22.1.1 (F:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
litenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfm
ygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirg
vnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkp
aknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl

Timeline for d3bxbf_:

• d3bxbf_ first appeared in SCOPe 2.01
  
• d3bxbf_ appears in SCOPe 2.06
  
• d3bxbf_ appears in the current release, SCOPe 2.08