SCOPe 2.05: Domain d3bxbe_: 3bxb E:

Lineage for d3bxbe_ (3bxb E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries)

8. Domain d3bxbe_: 3bxb E: [172911]
   automated match to d1uisa_

Details for d3bxbe_

PDB Entry: 3bxb, 2.6 Å

PDB Description: monomeric far-red fluorescent protein mkate crystallized at ph 7.0

PDB Compounds: (E:) Far-red fluorescent protein mKate

SCOPe Domain Sequences for d3bxbe_:

Sequence; same for both SEQRES and ATOM records:

>d3bxbe_ d.22.1.1 (E:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
litenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsfm
ygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirg
vnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrskkp
aknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl

Timeline for d3bxbe_:

• d3bxbe_ first appeared in SCOPe 2.01
  
• d3bxbe_ appears in SCOPe 2.04
  
• d3bxbe_ appears in SCOPe 2.06
  
• d3bxbe_ appears in the current release, SCOPe 2.08