![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (13 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (20 PDB entries) |
![]() | Domain d1cfda_: 1cfd A: [17291] |
PDB Entry: 1cfd (more details)
SCOPe Domain Sequences for d1cfda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfda_ a.39.1.5 (A:) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]} adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee vdemireadidgdgqvnyeefvqmmtak
Timeline for d1cfda_: