SCOPe 2.08: Domain d3bx9b_: 3bx9 B:

Lineage for d3bx9b_ (3bx9 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (24 PDB entries)

8. Domain d3bx9b_: 3bx9 B: [172904]
   automated match to d1uisa_
   complexed with cit, gol

Details for d3bx9b_

PDB Entry: 3bx9, 1.8 Å

PDB Description: Monomeric Far-red Fluorescent Protein mKate Crystallized at pH 2.0

PDB Compounds: (B:) Far-red fluorescent protein mKate

SCOPe Domain Sequences for d3bx9b_:

Sequence; same for both SEQRES and ATOM records:

>d3bx9b_ d.22.1.1 (B:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
selitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilats
fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
rgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrsk
kpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl

Timeline for d3bx9b_:

• d3bx9b_ first appeared in SCOPe 2.01
  
• d3bx9b_ appears in SCOPe 2.07