Lineage for d3bx9a_ (3bx9 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1021950Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1022143Protein automated matches [190406] (14 species)
    not a true protein
  7. 1022322Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (14 PDB entries)
  8. 1022339Domain d3bx9a_: 3bx9 A: [172903]
    automated match to d1uisa_
    complexed with cit, gol

Details for d3bx9a_

PDB Entry: 3bx9 (more details), 1.8 Å

PDB Description: Monomeric Far-red Fluorescent Protein mKate Crystallized at pH 2.0
PDB Compounds: (A:) Far-red fluorescent protein mKate

SCOPe Domain Sequences for d3bx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bx9a_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
selitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilats
fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
rgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrsk
kpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl

SCOPe Domain Coordinates for d3bx9a_:

Click to download the PDB-style file with coordinates for d3bx9a_.
(The format of our PDB-style files is described here.)

Timeline for d3bx9a_: