SCOPe 2.08: Domain d1f71a_: 1f71 A:

Lineage for d1f71a_ (1f71 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (13 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (20 PDB entries)

8. Domain d1f71a_: 1f71 A: [17289]
   C-terminal domain
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1f71a_

PDB Entry: 1f71

PDB Description: refined solution structure of calmodulin c-terminal domain

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d1f71a_:

Sequence; same for both SEQRES and ATOM records:

>d1f71a_ a.39.1.5 (A:) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]}
eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
vqmmtak

Timeline for d1f71a_:

• d1f71a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f71a_ appears in SCOPe 2.07