| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Calmodulin [47516] (13 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (20 PDB entries) |
| Domain d1f71a_: 1f71 A: [17289] C-terminal domain fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1f71 (more details)
SCOPe Domain Sequences for d1f71a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f71a_ a.39.1.5 (A:) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]}
eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
vqmmtak
Timeline for d1f71a_: