Lineage for d3bwma_ (3bwm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892671Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2892682Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2892683Species Human (Homo sapiens) [TaxId:9606] [267759] (12 PDB entries)
  8. 2892690Domain d3bwma_: 3bwm A: [172888]
    automated match to d1h1da_
    complexed with dnc, k, mg, sam

Details for d3bwma_

PDB Entry: 3bwm (more details), 1.98 Å

PDB Description: Crystal Structure of Human Catechol O-Methyltransferase with bound SAM and DNC
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d3bwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwma_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Human (Homo sapiens) [TaxId: 9606]}
gdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsv
llelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqd
iipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfla
hvrgsscfecthyqsfleyrevvdglekaiykgp

SCOPe Domain Coordinates for d3bwma_:

Click to download the PDB-style file with coordinates for d3bwma_.
(The format of our PDB-style files is described here.)

Timeline for d3bwma_: