SCOPe 2.06: Domain d3bwdd_: 3bwd D:

Lineage for d3bwdd_ (3bwd D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries)

8. Domain d3bwdd_: 3bwd D: [172881]
   automated match to d1foeb_
   complexed with gdp, mg

Details for d3bwdd_

PDB Entry: 3bwd, 1.53 Å

PDB Description: Crystal structure of the plant Rho protein ROP5

PDB Compounds: (D:) Rac-like GTP-binding protein ARAC6

SCOPe Domain Sequences for d3bwdd_:

Sequence, based on SEQRES records:

>d3bwdd_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rfikcvtvgdgavgktcllisytsntfptdyvptvfdnfsanvvvngatvnlglwdtagq
edynrlrplsyrgadvfilafsliskasyenvskkwipelkhyapgvpivlvgtkldlrd
dkqffidhpgavpittvqgeelkkligapayiecssksqenvkgvfdaairvvlqp

Sequence, based on observed residues (ATOM records):

>d3bwdd_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rfikcvtvgdgavgktcllisytsntfpfsanvvlglwdtagedynrlrplsyrgadvfi
lafsliskasyenvskkwipelkhyapgvpivlvgtkldlrddkqffidhavpittvqge
elkkligapayiecssksqenvkgvfdaairvvlqp

Timeline for d3bwdd_:

• d3bwdd_ first appeared in SCOPe 2.01
  
• d3bwdd_ appears in SCOPe 2.05
  
• d3bwdd_ appears in SCOPe 2.07
  
• d3bwdd_ appears in the current release, SCOPe 2.08