Lineage for d3bwcb_ (3bwc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130945Species Trypanosoma cruzi [TaxId:353153] [188400] (11 PDB entries)
  8. 2130953Domain d3bwcb_: 3bwc B: [172880]
    automated match to d1xj5a_
    complexed with bme, sam

Details for d3bwcb_

PDB Entry: 3bwc (more details), 2.3 Å

PDB Description: Crystal structure of spermidine synthase from Trypanosoma cruzi in complex with SAM at 2.3 A resolution
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d3bwcb_:

Sequence, based on SEQRES records: (download)

>d3bwcb_ c.66.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
sggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvtd
ydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeqs
kqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklfgeafykd
vlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcgsigtlvc
skkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

Sequence, based on observed residues (ATOM records): (download)

>d3bwcb_ c.66.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
sggwfreepgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvtdydef
vyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeqskqhf
pqisrsladpratvrvgdglafvrqtpdntydvviidteafykdvlrilkpdgiccnqge
siwldleliekmsrfiretgfasvqyalmhvptypcgsigtlvcskkagvdvtkplrpve
dmpfakdlkyydsemhkasfalprfarhinn

SCOPe Domain Coordinates for d3bwcb_:

Click to download the PDB-style file with coordinates for d3bwcb_.
(The format of our PDB-style files is described here.)

Timeline for d3bwcb_: