Lineage for d3bwba_ (3bwb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130945Species Trypanosoma cruzi [TaxId:353153] [188400] (11 PDB entries)
  8. 2130958Domain d3bwba_: 3bwb A: [172877]
    automated match to d1xj5a_

Details for d3bwba_

PDB Entry: 3bwb (more details), 2.5 Å

PDB Description: Crystal structure of the apo form of spermidine synthase from Trypanosoma cruzi at 2.5 A resolution
PDB Compounds: (A:) spermidine synthase

SCOPe Domain Sequences for d3bwba_:

Sequence, based on SEQRES records: (download)

>d3bwba_ c.66.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
selisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgci
qvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgev
meqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklfgea
fykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcgsig
tlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

Sequence, based on observed residues (ATOM records): (download)

>d3bwba_ c.66.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
selisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgci
qvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgev
meqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpasklfgeafyk
dvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcgsigtlv
cskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

SCOPe Domain Coordinates for d3bwba_:

Click to download the PDB-style file with coordinates for d3bwba_.
(The format of our PDB-style files is described here.)

Timeline for d3bwba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bwbb_