Lineage for d3bw8b_ (3bw8 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000485Protein Exoenzyme c3 [56414] (4 species)
  7. 3000510Species Clostridium limosum [TaxId:1536] [188401] (1 PDB entry)
  8. 3000512Domain d3bw8b_: 3bw8 B: [172876]
    automated match to d1r45a_
    complexed with so4

Details for d3bw8b_

PDB Entry: 3bw8 (more details), 1.8 Å

PDB Description: Crystal structure of the Clostridium limosum C3 exoenzyme
PDB Compounds: (B:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d3bw8b_:

Sequence, based on SEQRES records: (download)

>d3bw8b_ d.166.1.1 (B:) Exoenzyme c3 {Clostridium limosum [TaxId: 1536]}
pyadsfkeftnidearawgdkqfakyklssseknaltiytrnaaringplranqgntngl
padirkeveqidksftkmqtpeniilfrgddpgylgpdfentilnrdgtinkavfeqvkl
rfkgkdrkeygyistslvngsafagrpiitkfkvldgskagyiepistfkgqlevllprs
stytisdmqiapnnkqiiitallkr

Sequence, based on observed residues (ATOM records): (download)

>d3bw8b_ d.166.1.1 (B:) Exoenzyme c3 {Clostridium limosum [TaxId: 1536]}
pyadsfkeftnidearawgdkqfakyklssseknaltiytrnaaringplranqgntngl
padirkeveqidksftkmqtpeniilfrgddpgylgpdfentilnrdgtinkavfeqvkl
rfkgkdrkeygyistslvngsafagrpiitkfkvldgskagyiepistlevllprsstyt
isdmqiapnnkqiiitallkr

SCOPe Domain Coordinates for d3bw8b_:

Click to download the PDB-style file with coordinates for d3bw8b_.
(The format of our PDB-style files is described here.)

Timeline for d3bw8b_: