SCOPe 2.08: Domain d3bw6a1: 3bw6 A:1-135

Lineage for d3bw6a1 (3bw6 A:1-135)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (5 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (3 proteins)

6. Protein automated matches [190918] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188402] (1 PDB entry)

8. Domain d3bw6a1: 3bw6 A:1-135 [172874]
   Other proteins in same PDB: d3bw6a2
   automated match to d1h8ma_
   complexed with so4

Details for d3bw6a1

PDB Entry: 3bw6, 2.5 Å

PDB Description: Crystal structure of the longin domain of yeast Ykt6

PDB Compounds: (A:) Synaptobrevin homolog YKT6

SCOPe Domain Sequences for d3bw6a1:

Sequence; same for both SEQRES and ATOM records:

>d3bw6a1 d.110.4.1 (A:1-135) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mriyyigvfrsggekalelsevkdlsqfgfferssvgqfmtffaetvasrtgagqrqsie
egnyighvyarsegicgvlitdkeypvrpaytllnkildeylvahpkeewadvtetndal
kmkqldtyiskyqdp

Timeline for d3bw6a1:

• d3bw6a1 first appeared in SCOPe 2.01, called d3bw6a_
  
• d3bw6a1 appears in SCOPe 2.07