Lineage for d3bw1b_ (3bw1 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1787219Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1787220Protein automated matches [190914] (10 species)
    not a true protein
  7. 1787229Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (6 PDB entries)
  8. 1787231Domain d3bw1b_: 3bw1 B: [172873]
    automated match to d1i81d_
    complexed with mpd, so4

Details for d3bw1b_

PDB Entry: 3bw1 (more details), 2.5 Å

PDB Description: Crystal structure of homomeric yeast Lsm3 exhibiting novel octameric ring organisation
PDB Compounds: (B:) U6 snRNA-associated Sm-like protein LSm3

SCOPe Domain Sequences for d3bw1b_:

Sequence, based on SEQRES records: (download)

>d3bw1b_ b.38.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
serrcemvfirgdtvtlistpsedddgavei

Sequence, based on observed residues (ATOM records): (download)

>d3bw1b_ b.38.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
serrcemvfirgdtvtlistpsavei

SCOPe Domain Coordinates for d3bw1b_:

Click to download the PDB-style file with coordinates for d3bw1b_.
(The format of our PDB-style files is described here.)

Timeline for d3bw1b_: